DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and CG13284

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001260523.1 Gene:CG13284 / 35021 FlyBaseID:FBgn0032614 Length:339 Species:Drosophila melanogaster


Alignment Length:217 Identity:64/217 - (29%)
Similarity:97/217 - (44%) Gaps:30/217 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ALITGGGNGLGRLLAERLGKMGTKVVIWDINK-KGIAETVQIVEEAGGYCKGYVVDISKKEEVYK 152
            |::||..:|:|:..|..|.:.|..:|:....| |.||.|.:|..:.....|....|.:|..||| 
  Fly    73 AVVTGATDGIGKEYARELARQGINLVLISRTKEKLIAVTNEIESQYKVKTKWIAADFAKGREVY- 136

  Fly   153 AADVIRDEVG--DITLLINNAGVV----SGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMIE 211
              |.|..|:.  |:.:|:||.|::    ..|.|:.  :.|:.....||:.:....|:..||:||.
  Fly   137 --DQIEKELAGIDVGILVNNVGMMYEHPESLDLVS--EDLLWNLLTVNMGSVTMLTRKILPQMIG 197

  Fly   212 NDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATGM 276
            ..:|.|..:.|.:....:..:..|.|||.....|.:|  |||||..| ||....:.|.|: .|.|
  Fly   198 RRKGAIVNLGSSSELQPLPNMTVYAASKKFVTYFSKA--LELEVAEH-NIHVQLVMPNFV-VTKM 258

  Fly   277 FDDVNARWVPTLNPNDVADRVI 298
                          |...|||:
  Fly   259 --------------NAYTDRVM 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 64/217 (29%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 64/217 (29%)
CG13284NP_001260523.1 DltE 70..323 CDD:223377 64/217 (29%)
17beta-HSD1_like_SDR_c 70..309 CDD:187614 64/217 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447614
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.