DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and HSD17B13

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_835236.2 Gene:HSD17B13 / 345275 HGNCID:18685 Length:300 Species:Homo sapiens


Alignment Length:272 Identity:109/272 - (40%)
Similarity:163/272 - (59%) Gaps:5/272 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DVAWFIICCIGYILQDLYYIAFGYPE--KELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDI 118
            ::...:|..|...|:.|  :.|..|:  |.:..:|.||||.|:|:||.......|..:.:|:|||
Human     6 EILLLLITIIYSYLESL--VKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDI 68

  Fly   119 NKKGIAETVQIVEEAGGYCKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTP 183
            ||:|:.||.....:.|.....||||.|.:||:|::.:.::.||||:|:::||||.|....||.|.
Human    69 NKRGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTK 133

  Fly   184 DHLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEA 248
            |..|.::|.||::.|||.|||.||.|:|.:.|||.|:||:.||.||..|:.||:||||||||...
Human   134 DEEITKTFEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRG 198

  Fly   249 LRLELEVLGHTNIRTTCICPFFIQATGMFDDVNARWVPTLNPNDVADRVIAAIRKNEKLAVIPGF 313
            |..||:.||.|.|:|:|:||.|:. ||...:.:.|..|.|..::|...:|..|..|:|:..:|.:
Human   199 LTSELQALGKTGIKTSCLCPVFVN-TGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSY 262

  Fly   314 LKVLLSFKWTFP 325
            :.:.|..:...|
Human   263 INIFLRLQKFLP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 96/216 (44%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 102/238 (43%)
HSD17B13NP_835236.2 17beta-HSDXI-like_SDR_c 38..277 CDD:187598 102/238 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 1 1.000 - - otm41147
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.