DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and CG15629

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_608859.1 Gene:CG15629 / 33679 FlyBaseID:FBgn0031630 Length:325 Species:Drosophila melanogaster


Alignment Length:288 Identity:114/288 - (39%)
Similarity:180/288 - (62%) Gaps:9/288 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DVAWFIICCIGYILQDLYYIAFGYPE-----KELNTDIALITGGGNGLGRLLAERLGKMGTKVVI 115
            |:..|.|..:.|:|:.:||...  |:     |:::..:.||||||.|:|||:|....::..::||
  Fly    23 DLLVFTIKSVYYVLESIYYSLL--PQRFRKLKDISGQVVLITGGGGGVGRLIALNFARLQARIVI 85

  Fly   116 WDINKKGIAETVQIVEEAG-GYCKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHL 179
            ||||::.|..||.::.:.| ..|||||||||.:|::|:.|..:.:|||.:.:||||||:|.....
  Fly    86 WDINQEAIKTTVDLLAKHGYDNCKGYVVDISDREQIYQRASQVTEEVGPVDILINNAGIVCCKPF 150

  Fly   180 LDTPDHLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVG 244
            .:..|.:|:.::|:|:::|:||.|||||.|:.|:||||.|:.|:.|.:|.....||.|:|:|.:|
  Fly   151 WELHDRVIQNTYNINIISHYWTVKAFLPHMMRNNRGHIVTVGSVTGMLGTYGCSDYAATKYACIG 215

  Fly   245 FDEALRLELEVLGHTNIRTTCICPFFIQATGMFDDVNARWVPTLNPNDVADRVIAAIRKNEKLAV 309
            |.|:|..:|:..|:..|:.:.|||::|. ||||..|..|.:|.|.|..||||:..|:|.||...|
  Fly   216 FHESLLTDLKAHGYDQIQMSLICPYYIN-TGMFSGVRPRMMPMLEPQYVADRIENAVRCNEVWCV 279

  Fly   310 IPGFLKVLLSFKWTFPWGCVGGLLKRLV 337
            :|..:::|...|...|......|:.|::
  Fly   280 LPNSIRLLTPLKCLLPAKMCWELMSRVI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 95/217 (44%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 103/240 (43%)
CG15629NP_608859.1 17beta-HSDXI-like_SDR_c 58..298 CDD:187598 103/240 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447542
Domainoid 1 1.000 91 1.000 Domainoid score I1741
eggNOG 1 0.900 - - E2759_KOG1201
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I1486
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114358at50557
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 1 1.000 - - mtm9177
orthoMCL 1 0.900 - - OOG6_100599
Panther 1 1.100 - - P PTHR24322
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1734
SonicParanoid 1 1.000 - - X140
1211.830

Return to query results.
Submit another query.