DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and Mfe2

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster


Alignment Length:232 Identity:57/232 - (24%)
Similarity:103/232 - (44%) Gaps:39/232 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IALITGGGNGLGRLLAERLGKMGTKVVIWDI---------NKKGIAETVQIVEEAGGYCKGYVVD 143
            :|::||.|.||||..|....:.|.|||:.|:         :::.....|..:.:|||..      
  Fly    14 VAVVTGAGAGLGREYALLFAERGAKVVVNDLGGTHSGDGASQRAADIVVDEIRKAGGEA------ 72

  Fly   144 ISKKEEVYKAADVIRDEV---GDITLLINNAGVVSGLHLLDTPDHLIERSFN----VNVMAHFWT 201
            ::....|...|.||...:   |.:.:|:||||::....|:.|.    |:.:|    |::...|..
  Fly    73 VADYNSVIDGAKVIETAIKAFGRVDILVNNAGILRDRSLVKTS----EQDWNLVNDVHLKGSFKC 133

  Fly   202 TKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCI 266
            |:|..|.|.:.:.|.|...:|.:|..|....|:|.|:|...:|....:.:|       ..|...:
  Fly   134 TQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIE-------GARNNVL 191

  Fly   267 CPFFI--QATGMFDDVNARWVPTLNPNDVADRVIAAI 301
            |...:  .|:.|.:.:    :|.:..|::..::||.:
  Fly   192 CNVIVPTAASRMTEGI----LPDILFNELKPKLIAPV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 55/228 (24%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 57/232 (25%)
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 57/232 (25%)
PRK07791 11..248 CDD:236099 57/232 (25%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.