DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and CG31810

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster


Alignment Length:214 Identity:60/214 - (28%)
Similarity:97/214 - (45%) Gaps:27/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ALITGGGNGLGRLLAERLGKMGTKVVIWDINKKG---IAETVQIVEEAGGYCKGYVVDISKKEEV 150
            |::||..:|:|:..|..|.:.|..:|:  :::|.   ||.|.:|..:.....|..|.|.:|..||
  Fly    59 AVVTGATDGIGKEYARELARQGLNLVL--VSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREV 121

  Fly   151 YKAADVIRDEVG-DITLLINNAGVVSGLHLLD-TPDHLIERSFNVNVMAHFWTTKAFLPKMIEND 213
            |  |.:.::..| ::.:|:||.|.:.....|| ..:.::.....|||.:....|:..||:||...
  Fly   122 Y--AHIEKELNGIEVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRR 184

  Fly   214 RGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATGMFD 278
            :|.|..:.|.:.......|..|.|:|.....|.:.  ||.||..| ||....:.|.|: ||.|  
  Fly   185 KGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKG--LEYEVAEH-NIHVQLVMPAFV-ATNM-- 243

  Fly   279 DVNARWVPTLNPNDVADRV 297
                        |..:|:|
  Fly   244 ------------NSYSDKV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 60/214 (28%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 60/214 (28%)
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 60/214 (28%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 60/214 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447612
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.