DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and CG31809

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster


Alignment Length:214 Identity:60/214 - (28%)
Similarity:97/214 - (45%) Gaps:27/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ALITGGGNGLGRLLAERLGKMGTKVVIWDINKKG---IAETVQIVEEAGGYCKGYVVDISKKEEV 150
            |::||..:|:|:..|..|.:.|..:|:  :::|.   ||.|.:|..:.....|..|.|.:|..||
  Fly    51 AVVTGATDGIGKEYARELARQGLNLVL--VSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREV 113

  Fly   151 YKAADVIRDEVG-DITLLINNAGVVSGLHLLD-TPDHLIERSFNVNVMAHFWTTKAFLPKMIEND 213
            |  |.:.::..| ::.:|:||.|.:.....|| ..:.::.....|||.:....|:..||:||...
  Fly   114 Y--AHIEKELNGIEVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRR 176

  Fly   214 RGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATGMFD 278
            :|.|..:.|.:.......|..|.|:|.....|.:.  ||.||..| ||....:.|.|: ||.|  
  Fly   177 KGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKG--LEYEVAEH-NIHVQLVMPAFV-ATNM-- 235

  Fly   279 DVNARWVPTLNPNDVADRV 297
                        |..:|:|
  Fly   236 ------------NSYSDKV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 60/214 (28%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 60/214 (28%)
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 60/214 (28%)
DltE 50..302 CDD:223377 60/214 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447613
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.