DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and Dhrs3

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001032276.3 Gene:Dhrs3 / 313689 RGDID:1305584 Length:302 Species:Rattus norvegicus


Alignment Length:284 Identity:103/284 - (36%)
Similarity:159/284 - (55%) Gaps:27/284 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LQDLYYI---AFG--YPEK--ELNTDIALITGGGNGLGRLLAERLGKMGT-KVVIWDINKKGIAE 125
            ||.:|.:   |.|  .|.|  :|:.:..||||||.|:||.||....:.|. |:|:|...:|.:.|
  Rat    14 LQMIYLVTKAAVGLVLPPKLRDLSRESVLITGGGRGIGRHLAREFAERGARKIVLWGRTEKCLKE 78

  Fly   126 TVQIVEEAGGYCKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERS 190
            |.:.:.:.|..|..::.|:..:||||:.|..:|::|||||:|:|||.||.|..|:|:.|..:.:|
  Rat    79 TTEEIRQMGTECHYFICDVGNREEVYQMAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKS 143

  Fly   191 FNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEV 255
            .:||.:..|||||||||:|:|...|||..:.|:.....|...:|||.||.:|..|.|:|.|.|  
  Rat   144 QHVNTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGL-- 206

  Fly   256 LGHTNIRTTCICPFFIQATGMFDDVNARW---VPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVL 317
            |....:..|.:.||. .:|.||..:..|:   .|.|.|..||.|.:.|:::|:.|.::|..:.:|
  Rat   207 LDCPGVSATTVLPFH-TSTEMFQGMRVRFPNLFPPLKPETVARRTVEAVQQNQALLLLPWTMNIL 270

  Fly   318 LSFKWTFPWGCVGGLLKRLVPDAS 341
            :             :||.::|.|:
  Rat   271 I-------------ILKSILPQAA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 88/222 (40%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 91/243 (37%)
Dhrs3NP_001032276.3 PRK09072 35..288 CDD:236372 96/263 (37%)
17beta-HSDXI-like_SDR_c 53..281 CDD:187598 85/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X140
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.