DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and CG3603

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster


Alignment Length:232 Identity:66/232 - (28%)
Similarity:106/232 - (45%) Gaps:17/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEEAGGYCKGYV-VDISKKEEV- 150
            :||:||.|:|:||.....|.:.|.||:..|.|.|...||||   |.|......: ||:|..:.| 
  Fly    10 VALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQ---ELGSERSAALEVDVSSAQSVQ 71

  Fly   151 YKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMIEN--D 213
            :..|:.::......|:::|:||:....:||..|:...:..:.||:...|..|:|:...|||.  :
  Fly    72 FSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQKLE 136

  Fly   214 RGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATGMFD 278
            .|.|..::|:...:......:|.|:|...:.|.|....|   .|...||..||.|      |..|
  Fly   137 NGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKE---FGKFGIRVNCILP------GYID 192

  Fly   279 DVNARWVPTLNPNDVADRV-IAAIRKNEKLAVIPGFL 314
            ......||.....:|..|. :..:.:.|::|.:..||
  Fly   193 TPMVAVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 62/215 (29%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 66/232 (28%)
CG3603NP_001259199.1 fabG 6..248 CDD:235546 66/232 (28%)
BKR_SDR_c 9..248 CDD:187594 66/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.