DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and Hsd17b13

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001009684.1 Gene:Hsd17b13 / 305150 RGDID:1359553 Length:300 Species:Rattus norvegicus


Alignment Length:271 Identity:109/271 - (40%)
Similarity:162/271 - (59%) Gaps:9/271 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IICCIGYI----LQDLYYIAFGYPE--KELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDIN 119
            ::..:|.|    |:.|  :.|..|:  |.:.....||||.|:|:|||.|....|..:::|:|||:
  Rat     7 LLLLVGIIIYSYLESL--VKFFIPQRRKSVAGQTVLITGAGHGIGRLTAYEFAKQKSRLVLWDIS 69

  Fly   120 KKGIAETVQIVEEAGGYCKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPD 184
            |.|:.||.....:.|.....:|||.|.:.|:||:.|.::.|||||.:::||||.:....||.|.|
  Rat    70 KHGVEETAAKCRKLGAVVHVFVVDCSNRAEIYKSVDQVKKEVGDIEIVVNNAGAIYPADLLSTKD 134

  Fly   185 HLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEAL 249
            ..|.::|.||::.|||..||.||.|:..:.|||.|:||:.||..|..|:.||:||||||||..||
  Rat   135 EEITKTFEVNILGHFWIIKALLPSMLRRNSGHIVTVASVCGHRVIPYLIPYCSSKFAAVGFHRAL 199

  Fly   250 RLELEVLGHTNIRTTCICPFFIQATGMFDDVNARWVPTLNPNDVADRVIAAIRKNEKLAVIPGFL 314
            ..||:.||.|.|:|:|:||.|:. ||...:.:.|..|.|.|::||..:|..|..|:|:..:|.::
  Rat   200 TAELDTLGKTGIKTSCLCPVFVN-TGFTKNPSTRLWPVLEPDEVARSLIDGILTNKKMIFVPSYI 263

  Fly   315 KVLLSFKWTFP 325
            .:.|..:..||
  Rat   264 NISLIVEMFFP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 95/216 (44%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 102/238 (43%)
Hsd17b13NP_001009684.1 adh_short 37..228 CDD:278532 88/191 (46%)
17beta-HSDXI-like_SDR_c 38..277 CDD:187598 102/238 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 208 1.000 Domainoid score I2765
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I3313
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 1 1.000 - - otm45287
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.