DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and Sdr16c5

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001100104.1 Gene:Sdr16c5 / 297805 RGDID:1565999 Length:309 Species:Rattus norvegicus


Alignment Length:262 Identity:114/262 - (43%)
Similarity:166/262 - (63%) Gaps:5/262 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ILQDLYYIAFGYPEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEE 132
            ||:.|.......|.|.:..::.||||.|:|||||||.:..::|:.:|:||:||:...||.||.:|
  Rat    22 ILEALLSHVISKPRKNVAGEVVLITGAGSGLGRLLALQFARLGSVLVLWDVNKETNEETRQIAQE 86

  Fly   133 AGGY-CKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVM 196
            ||.. ...|..|.|::||||:.||.::.||||:::||||||:|:|...||.||.|:|:|.:||..
  Rat    87 AGAIRVHAYTCDCSQREEVYRVADQVKKEVGDVSILINNAGIVTGRKFLDCPDDLMEKSLDVNFK 151

  Fly   197 AHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNI 261
            ||.|..|||||.||.|:.||:..|:|.||.:|::.|.|||||||||:||.|::.:|........|
  Rat   152 AHLWMYKAFLPAMIANNHGHLVCISSSAGLIGVNGLSDYCASKFAALGFAESMFVETLAQKQRGI 216

  Fly   262 RTTCICPFFIQATGMFDDVNAR---WVPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLLSFKWT 323
            :||.:|||||: ||||:....:   .:|.|:|.....:::.||.:.:....:|.||..::..|..
  Rat   217 KTTIVCPFFIK-TGMFEGCTTKCPNLLPILDPEYAVRKIVDAILQEQLYLYMPKFLYFIMFLKSF 280

  Fly   324 FP 325
            .|
  Rat   281 LP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 103/220 (47%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 109/242 (45%)
Sdr16c5NP_001100104.1 adh_short 41..231 CDD:278532 97/190 (51%)
17beta-HSDXI-like_SDR_c 42..284 CDD:187598 109/242 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15039
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 1 1.000 - - otm45287
orthoMCL 1 0.900 - - OOG6_100599
Panther 1 1.100 - - LDO PTHR24322
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X140
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.