DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and Hsd17b11

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001004209.1 Gene:Hsd17b11 / 289456 RGDID:1303235 Length:298 Species:Rattus norvegicus


Alignment Length:278 Identity:122/278 - (43%)
Similarity:175/278 - (62%) Gaps:9/278 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IICCIGYILQDLYYIAFGYPEKELNT--DIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGI 123
            |:.||...::.|      .|:|:.:.  :|.||||.|:|:|||.|....|:.||:|:|||||.||
  Rat    15 IVFCIESFIKRL------IPKKKKSVAGEIVLITGAGHGIGRLTAYEFAKLNTKLVLWDINKNGI 73

  Fly   124 AETVQIVEEAGGYCKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIE 188
            .||.....:.|.....:|||.|::||:|.|...:::||||:::|:||||||....|..|.|..||
  Rat    74 EETAAKCRKLGAQVHPFVVDCSQREEIYSAVRKVKEEVGDVSILVNNAGVVYTADLFATQDPQIE 138

  Fly   189 RSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLEL 253
            ::|.|||:|||||||||||.|::|:.||:.|:||.|||..:..|:.||:||||||||..||..||
  Rat   139 KTFEVNVLAHFWTTKAFLPAMMKNNHGHVVTVASAAGHTVVPFLLAYCSSKFAAVGFHRALTDEL 203

  Fly   254 EVLGHTNIRTTCICPFFIQATGMFDDVNARWVPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLL 318
            ..||.|.:||:|:||.||. ||...:.:....|||.|.:|.:.::..|..|:|:..:||.:.:|.
  Rat   204 AALGCTGVRTSCLCPNFIN-TGFIKNPSTNLGPTLEPEEVVEHLMHGILTNQKMIFVPGSIALLT 267

  Fly   319 SFKWTFPWGCVGGLLKRL 336
            ..:..||...:..|.:|:
  Rat   268 VLERVFPERFLDVLKRRI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 107/218 (49%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 114/239 (48%)
Hsd17b11NP_001004209.1 adh_short 37..228 CDD:278532 101/191 (53%)
17beta-HSDXI-like_SDR_c 38..277 CDD:187598 114/239 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 208 1.000 Domainoid score I2765
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I3313
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 1 1.000 - - otm45287
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.