DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and SPBC16H5.14c

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_595933.1 Gene:SPBC16H5.14c / 2539946 PomBaseID:SPBC16H5.14c Length:286 Species:Schizosaccharomyces pombe


Alignment Length:230 Identity:59/230 - (25%)
Similarity:89/230 - (38%) Gaps:30/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IALITGGGNGLGRLLAERLGKMGTKVVIWD---------INKKGIAETVQIVEEAGGYCKGYVVD 143
            :.:||||...||..:.:.....|..|...|         .|.|..|....|.::..  .:|.|..
pombe    37 LIVITGGSGILGHAIIQEALDRGFSVASLDSTEPASFLQYNSKFSALKCNITKDKD--VEGCVHS 99

  Fly   144 ISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPK 208
            :.|......|             |||.|.:....|||......:::.|..||:.....|.|..|.
pombe   100 LKKMNRTPFA-------------LINAAAIAPKNHLLSISRQELQKCFETNVIGQLAITSALFPL 151

  Fly   209 MIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLG-HTNIRTTCICPFFIQ 272
            ::::...|:..|||...:.....:..|.:||.|.|...|.  ||.|||. |.|.:.:......|:
pombe   152 LLQDPNPHVVNIASSLAYFSAMGVGAYSSSKAALVSLHET--LEEEVLSQHPNFKFSLYVLGQIK 214

  Fly   273 ATGMF--DDVNARWVPTLNPNDVADRVIAAIRKNE 305
            :| ||  |..|....|.|.|.::|..:|..:..|:
pombe   215 ST-MFEKDTPNRVLAPLLEPQNLAKIIIQNLYTNK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 57/222 (26%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 59/230 (26%)
SPBC16H5.14cNP_595933.1 17beta-HSDXI-like_SDR_c 37..271 CDD:187598 59/230 (26%)
adh_short 38..225 CDD:278532 52/204 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100599
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1734
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.