DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and CG30495

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster


Alignment Length:310 Identity:81/310 - (26%)
Similarity:116/310 - (37%) Gaps:81/310 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAET-VQIVEEAGG------YCKGYVVDIS 145
            :|::|||..|||:.....|.:.|..|.:...||:.:... .:||:|.|.      .|     |:|
  Fly    47 VAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNSNVFSREC-----DLS 106

  Fly   146 KKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMI 210
            ..:.:.|.|:..:.|...:.:|||||||....|.|....  .|....||.:.||..|...|..:.
  Fly   107 SLDSIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEG--FEMHLGVNHIGHFLLTNLLLGVLE 169

  Fly   211 ENDRGHIATIASLAGHVGISKLVD------------YCASKFAAVGFDEALRLELEVLGHTNIRT 263
            .:....:..:||.|...|..|:.|            ||.||.|.:.|...|...||..|.|    
  Fly   170 RSAPSRVVVVASRAHERGQIKVDDINSSDFYDEGVAYCQSKLANILFTRELAKRLEGTGVT---- 230

  Fly   264 TCICPFFIQATGMFDDVNARWVPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLLSFKWTFPWGC 328
                            |||     |||. :||..||               :.::.|:..|....
  Fly   231 ----------------VNA-----LNPG-IADTEIA---------------RNMIFFQTKFAQYV 258

  Fly   329 VGGLLKRLVPDASPHGLPSSIAVPTVPLNSNSKLTAADIAALDAELSSVT 378
            |..:|:           |...||...|.| .::.|.  .||||.:|..|:
  Fly   259 VETILR-----------PLLWAVMKTPKN-GAQTTL--YAALDPDLERVS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 63/229 (28%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 67/258 (26%)
CG30495NP_001260785.1 FabG 44..296 CDD:223959 81/310 (26%)
NADB_Rossmann 45..323 CDD:304358 81/310 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.