DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and Hsd17b13

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_932147.2 Gene:Hsd17b13 / 243168 MGIID:2140804 Length:304 Species:Mus musculus


Alignment Length:246 Identity:101/246 - (41%)
Similarity:148/246 - (60%) Gaps:3/246 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 IAFGYP--EKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEEAGGYC 137
            :.|..|  .|.:.....||||.|:|:|||.|....|..:::|:|||||:|:.||.....:.|...
Mouse    23 VKFFIPRRRKSVTGQTVLITGAGHGIGRLTAYEFAKQKSRLVLWDINKRGVEETADKCRKLGAVV 87

  Fly   138 KGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTT 202
            ..:|||.|.:.|:|.:.|.::.||||:.:::||||.:....||...|..|.::|.||::.|||..
Mouse    88 HVFVVDCSNRAEIYNSVDQVKREVGDVEIVVNNAGAIYPADLLSAKDEEITKTFEVNILGHFWII 152

  Fly   203 KAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCIC 267
            ||.||.|:..:.|||.|:||:.||..|..|:.||:||||||||..||..||:.||.|.|:|:|:|
Mouse   153 KALLPSMLRRNSGHIVTVASVCGHGVIPYLIPYCSSKFAAVGFHRALTAELDTLGKTGIQTSCLC 217

  Fly   268 PFFIQATGMFDDVNARWVPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLL 318
            |.|:. ||...:.:.|..|.|.|.:||..:|..|..|:|:..:|.::.:.|
Mouse   218 PVFVN-TGFTKNPSTRLWPVLEPEEVARSLINGILTNKKMIFVPSYINISL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 93/216 (43%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 98/231 (42%)
Hsd17b13NP_932147.2 adh_short 37..228 CDD:278532 86/191 (45%)
17beta-HSDXI-like_SDR_c 38..269 CDD:187598 98/231 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..304
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2768
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 231 1.000 Inparanoid score I3425
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.