DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and dhs-29

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_509294.1 Gene:dhs-29 / 181027 WormBaseID:WBGene00000992 Length:427 Species:Caenorhabditis elegans


Alignment Length:282 Identity:89/282 - (31%)
Similarity:146/282 - (51%) Gaps:18/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LWNTWDAFADVAWFIICCIGYILQDLY-------YIAFGYPEKELNTDIALITGGGNGLGRLLAE 104
            ::.:|      ||.:...:|..|:.|:       :......:|.:.....:|||||:||||.:|.
 Worm     1 MYTSW------AWKLWSTLGVALRILFIDIPMDIHRFLNLRQKSVQGQTVIITGGGSGLGRAMAL 59

  Fly   105 RLGKMGTKVVIWDINKKGIAETVQIVEEAGGYCKGYVVDISKKEEVYKAADVIRDEVGDITLLIN 169
            ...|...||.|.|:||:|..|||:.:...|...|.:..|||..:.:.|.|..|.|..||:.::|.
 Worm    60 DFAKRKAKVAIIDVNKEGGLETVKTIAAEGNMAKFWYCDISDVDNMKKTAKEIEDTFGDVNIVIC 124

  Fly   170 NAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVD 234
            ||.::|....::..|.|:.:..:||:.....|.:||||||...:.|||..:.|:||..|.:..:.
 Worm   125 NAAILSFTSFMEISDELLRKCLDVNIFGTINTIRAFLPKMETKNDGHIVCVCSIAGWSGETMGLS 189

  Fly   235 YCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATGMFDDVNAR----WVPTLNPNDVAD 295
            ||.||||..|..|:|::||...|...|:||.:.|:|.: |.|..:.|.|    |.|.::....:.
 Worm   190 YCTSKFAVRGAMESLQMELRDRGLEGIKTTTLYPYFAR-TPMILENNMRPTCTWFPFMSIRSCSK 253

  Fly   296 RVIAAIRKNEKLAVIPGFLKVL 317
            |::.:|.|.:..|.:|.::.::
 Worm   254 RMVDSILKEKVHAFVPSYITLI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 79/220 (36%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 82/234 (35%)
dhs-29NP_509294.1 adh_short 42..230 CDD:278532 72/188 (38%)
NADB_Rossmann 43..281 CDD:304358 82/234 (35%)
DUF4499 322..416 CDD:291595
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100599
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.