DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9265 and RDH10

DIOPT Version :9

Sequence 1:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_742034.1 Gene:RDH10 / 157506 HGNCID:19975 Length:341 Species:Homo sapiens


Alignment Length:304 Identity:111/304 - (36%)
Similarity:160/304 - (52%) Gaps:40/304 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VAW-FIICCIGYILQDLYYIAFGYPEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINK 120
            |.| |::....::::.        .||.:...:.||||.|:|||||.|....:....:|:||||.
Human    14 VLWAFVLAAARWLVRP--------KEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVLWDINT 70

  Fly   121 KGIAETVQIV---------------------EEAGGYCK----GYVVDISKKEEVYKAADVIRDE 160
            :...||..:|                     ||...:|.    .|..|:.|:|.||..|:.:|.|
Human    71 QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVGKRENVYLTAERVRKE 135

  Fly   161 VGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAG 225
            ||::::|:||||||||.|||:.||.||||:..||..|||||||||||.|:|.:.|||.|:||..|
Human   136 VGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLG 200

  Fly   226 HVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATGMFDDVNAR-----WV 285
            ....:.:.|||||||..|||.|:|..||:......|:||.:||:.:. ||||.....|     ::
Human   201 LFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVD-TGMFRGCRIRKEIEPFL 264

  Fly   286 PTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLLSFKWTFPWGCV 329
            |.|.|:....:.:.||..::.:...|..:.::...|...|:..|
Human   265 PPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMKSILPFEAV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9265NP_001260655.1 fabG 82..299 CDD:235546 101/246 (41%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 105/269 (39%)
RDH10NP_742034.1 17beta-HSDXI-like_SDR_c 38..307 CDD:187598 105/269 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3528
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 1 1.000 - - otm41147
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1734
SonicParanoid 1 1.000 - - X140
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.