DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Itgbn and ITGBL1

DIOPT Version :9

Sequence 1:NP_001303333.1 Gene:Itgbn / 35368 FlyBaseID:FBgn0010395 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_004782.1 Gene:ITGBL1 / 9358 HGNCID:6164 Length:494 Species:Homo sapiens


Alignment Length:391 Identity:112/391 - (28%)
Similarity:152/391 - (38%) Gaps:107/391 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 CPCQ----ETPDPENEEGRFLCDYKGYLYCGMCECDEGWTGTYCNCPT--DATNVTSNEALLQKC 516
            |.|.    ||.|.....|...||      ||.|:||:||.|..|..||  |.|...||    |.|
Human    89 CECHEWVCETYDGSTCAGHGKCD------CGKCKCDQGWYGDACQYPTNCDLTKKKSN----QMC 143

  Fly   517 RQPFSDKSTSELVCSNHGDCDCGTCLCDPG-----YTGPFCEC--RECLDCD-EKL----ADCFC 569
                  |::.:::|||.|.|.||.|.||..     ..|.||||  |||:|.: |::    ..|:|
Human   144 ------KNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYC 202

  Fly   570 GQCVCKYGWSGSKC--NCD----GDTDACVGPTGEICSERGTCQCEECQCEE--------PYLGK 620
            |.|.||.||.|.||  .||    .....|..|.|:|||.||||.|.||.|.:        ...|.
Human   203 GNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGD 267

  Fly   621 FCEIDPEKD---------NKLCLFYEPC-------------------VTCLIEQKQGMGVCENLT 657
            .||.| |:|         :..|..:..|                   .:|.:..::.:..|:..:
Human   268 TCECD-ERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSS 331

  Fly   658 EI-CSSLDRQE-----TYP------YNFVHELDPEQDQCLVRLV-NKHG------IQCDSFFVYQ 703
            :: ||...:.|     .||      |....|.|..:.:.|..:| ..||      ..|:..:..:
Human   332 DLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGK 396

  Fly   704 VIDH---SNFLTIQAVD-CEPPDYVALVGYISAFTLLIGLLIIFIILWYIRAK----DAREYAKF 760
            :..|   .|....|:.: ||..|.:...|..|..   .|..|.....|||..:    |.|:..|.
Human   397 LCQHPRKCNMTEEQSKNLCESADGILCSGKGSCH---CGKCICSAEEWYISGEFCDCDDRDCDKH 458

  Fly   761 E 761
            :
Human   459 D 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ItgbnNP_001303333.1 INB 38..460 CDD:197563 1/1 (100%)
EGF_2 524..552 CDD:285248 11/32 (34%)
Integrin_b_cyt 748..785 CDD:285884 5/18 (28%)
ITGBL1NP_004782.1 Cysteine-rich tandem repeats 51..494 112/391 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1226
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10082
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.