DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9270 and YKR104W

DIOPT Version :9

Sequence 1:NP_995741.2 Gene:CG9270 / 35366 FlyBaseID:FBgn0032908 Length:1292 Species:Drosophila melanogaster
Sequence 2:NP_013030.1 Gene:YKR104W / 853979 SGDID:S000001812 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:135/307 - (43%)
Similarity:197/307 - (64%) Gaps:29/307 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   995 MTSVERVLEYRHLEAEGEFESPDDKKPPMNWPQEGLISAEQLSLRYNPDPKADRVLKSLNFIIMP 1059
            |:||||:.||..:.:    ||.....||.||||.|.:..:.|||||:  |.:.:.|.:::|.:..
Yeast     1 MSSVERIKEYTDIPS----ESNGYISPPANWPQTGDVELKNLSLRYS--PHSSKALDNVSFKVKA 59

  Fly  1060 REKIGIVGRTGAGKSSLINALFRLS-YNEGSLVIDNTDILGIGLHDLRSKISIIPQEPVLFSGTL 1123
            ..|:||||||||||||:|.|::||| :..|::.|||.||..|.|..||:.||.|||:|.||.||:
Yeast    60 GTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTV 124

  Fly  1124 RCNLDPFEQYADEKLWEALEEVHLKDEVSEL--------PN-----------GLESVVAEGGSNY 1169
            |.|||||::|:|.:::..|.:|.|.:|..||        ||           .|.:||..||||.
Yeast   125 RSNLDPFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRFIDLNTVVKSGGSNL 189

  Fly  1170 SVGQRQLVCLARAILRENRILVMDEATANVDPQTDALIQSTIRRKFRDCTVLTIAHRLNTIIDSD 1234
            |.|||||:||||::|....|:::|||||::|..:||.||.|||...::.|:|||||||.::||.|
Yeast   190 SQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETMKNTTILTIAHRLRSVIDYD 254

  Fly  1235 RVMVLDAGTLVEFGSPFELLTQSWSKVFYGMVLQTGRSSFEHLLKLA 1281
            :::|::.|.:.|:..|:.|::.. :.:||.:..|:|  .||:|.:||
Yeast   255 KILVMEMGRVKEYDHPYTLISDR-NTIFYRLCRQSG--EFENLFELA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9270NP_995741.2 CFTR_protein 6..1257 CDD:273530 126/281 (45%)
ABC_membrane 92..362 CDD:294371
ABCC_MRP_domain1 412..611 CDD:213217
ABC_membrane 718..981 CDD:294371
ABCC_MRP_domain2 1029..1250 CDD:213211 109/240 (45%)
YKR104WNP_013030.1 ABCC_NFT1 27..270 CDD:213269 112/244 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344655
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.