DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9270 and LOC110439293

DIOPT Version :9

Sequence 1:NP_995741.2 Gene:CG9270 / 35366 FlyBaseID:FBgn0032908 Length:1292 Species:Drosophila melanogaster
Sequence 2:XP_021330365.1 Gene:LOC110439293 / 110439293 -ID:- Length:174 Species:Danio rerio


Alignment Length:104 Identity:22/104 - (21%)
Similarity:39/104 - (37%) Gaps:22/104 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 FLWL-GPLELLISSYFLYQQIGVASL----YGIVILLL---FLPIQTFLSRLTSRLRHQTALRTD 267
            :||: .|...|...::...:|.::||    .|:.:.|.   ||.....|......:.|.......
Zfish    43 YLWICAPFYCLYLKFYDNGRISISSLCCAKTGLALCLASFGFLETVYLLVERRRDIEHHMVFLLS 107

  Fly   268 QRVRMMNEIISGIQVIKMYTWEKPFGRLIERLR--RSEM 304
            ..:|.:..|::.:.:            .:||||  ||.|
Zfish   108 PIIRSLTMILAMLMI------------HLERLRGFRSSM 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9270NP_995741.2 CFTR_protein 6..1257 CDD:273530 22/104 (21%)
ABC_membrane 92..362 CDD:294371 22/104 (21%)
ABCC_MRP_domain1 412..611 CDD:213217
ABC_membrane 718..981 CDD:294371
ABCC_MRP_domain2 1029..1250 CDD:213211
LOC110439293XP_021330365.1 SunT 5..>161 CDD:331423 22/104 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.