DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9272 and ATNTH1

DIOPT Version :9

Sequence 1:NP_610078.2 Gene:CG9272 / 35365 FlyBaseID:FBgn0032907 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_565725.1 Gene:ATNTH1 / 817703 AraportID:AT2G31450 Length:379 Species:Arabidopsis thaliana


Alignment Length:357 Identity:137/357 - (38%)
Similarity:188/357 - (52%) Gaps:53/357 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GAAGSSSSVFFSPVQTRKQRLLNGEAVKKTNIKMEPLSPARVAPKKFRKDDRMVTRVQMGSATVV 112
            ||:||.:.|:     |||:||           |.||..|......|             |..|..
plant    58 GASGSETRVY-----TRKKRL-----------KQEPFEPLEKYSGK-------------GVNTHK 93

  Fly   113 ICKVVPDAVDSPVRVDKIREEVEPQIKQEAPEDSPSFSEVQA---PHPLWFNHLENIRIMRNSRT 174
            :|. :||..|.     ..::.:.......:.|.|.:.:.|:.   |...|...||.||.||:|..
plant    94 LCG-LPDIEDF-----AYKKTIGSPSSSRSTETSITVTSVKTAGYPPENWVEVLEGIRQMRSSED 152

  Fly   175 APVDTMGCHRCADLKADSKTQRFQNLVALMLSSQTKDQTTYEAMNRLKDRG-LTPLKVKEMPVTE 238
            ||||:|||.:.......:: :||..|:..:||||||||....|::||...| |||..|.:...:.
plant   153 APVDSMGCDKAGSFLPPTE-RRFAVLLGALLSSQTKDQVNNAAIHRLHQNGLLTPEAVDKADEST 216

  Fly   239 LENLLHPVSFYKNKAKYLKQTVEILTDKYGSDIPDNVKDLVALPGVGPKMAHICMAVAWNKITGI 303
            ::.|::||.||..||.|:|:...|...||..|||.::.||::|||:||||||:.:.:|||.:.||
plant   217 IKELIYPVGFYTRKATYMKKIARICLVKYDGDIPSSLDDLLSLPGIGPKMAHLILHIAWNDVQGI 281

  Fly   304 GVDVHVHRLSNRLGWVPKP-----TKEPEQTRVALEKWLPFSLWSEVNHLFVGFGQTICTPVKPN 363
            .||.||||:.||||||.:|     |..||:|||||::|||...|..:|.|.|||||.||||::|.
plant   282 CVDTHVHRICNRLGWVSRPGTKQKTTSPEETRVALQQWLPKEEWVAINPLLVGFGQMICTPIRPR 346

  Fly   364 CGECLNKDICPSAHAET--------KEKRKKD 387
            |..|....:||:|..||        |..|.|:
plant   347 CEACSVSKLCPAAFKETSSPSSKLKKSNRSKE 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9272NP_610078.2 Nth 169..376 CDD:223255 101/212 (48%)
ENDO3c 205..355 CDD:214684 78/155 (50%)
FES 356..376 CDD:197771 9/19 (47%)
ATNTH1NP_565725.1 Nth 173..362 CDD:223255 92/188 (49%)
ENDO3c 174..336 CDD:238013 78/161 (48%)
FES 339..359 CDD:197771 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 128 1.000 Domainoid score I1734
eggNOG 1 0.900 - - E1_COG0177
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I1176
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322642at2759
OrthoFinder 1 1.000 - - FOG0003205
OrthoInspector 1 1.000 - - otm2760
orthoMCL 1 0.900 - - OOG6_100563
Panther 1 1.100 - - LDO PTHR43286
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2154
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.