DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9272 and NTHL1

DIOPT Version :9

Sequence 1:NP_610078.2 Gene:CG9272 / 35365 FlyBaseID:FBgn0032907 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_002519.2 Gene:NTHL1 / 4913 HGNCID:8028 Length:304 Species:Homo sapiens


Alignment Length:277 Identity:135/277 - (48%)
Similarity:166/277 - (59%) Gaps:31/277 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 REEVEPQIKQE-APEDSPSFSEVQAP---------------------HPL---------WFNHLE 164
            |||..|..::| |.|...|.|.|:.|                     .||         |...|.
Human    25 REEPGPLRRREAAAEARKSHSPVKRPRKAQRLRVAYEGSDSEKGEGAEPLKVPVWEPQDWQQQLV 89

  Fly   165 NIRIMRNSRTAPVDTMGCHRCADLKADSKTQRFQNLVALMLSSQTKDQTTYEAMNRLKDRGLTPL 229
            |||.|||.:.||||.:|...|.|..|..|.:|:|.|::||||||||||.|..||.||:.||||..
Human    90 NIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVD 154

  Fly   230 KVKEMPVTELENLLHPVSFYKNKAKYLKQTVEILTDKYGSDIPDNVKDLVALPGVGPKMAHICMA 294
            .:.:.....|..|::||.|:::|.||:|||..||...||.|||.:|.:|||||||||||||:.||
Human   155 SILQTDDATLGKLIYPVGFWRSKVKYIKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMA 219

  Fly   295 VAWNKITGIGVDVHVHRLSNRLGWVPKPTKEPEQTRVALEKWLPFSLWSEVNHLFVGFGQTICTP 359
            |||..::||.||.||||::|||.|..|.||.||:||.|||:|||..||.|:|.|.|||||..|.|
Human   220 VAWGTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLP 284

  Fly   360 VKPNCGECLNKDICPSA 376
            |.|.|..|||:.:||:|
Human   285 VHPRCHACLNQALCPAA 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9272NP_610078.2 Nth 169..376 CDD:223255 116/206 (56%)
ENDO3c 205..355 CDD:214684 88/149 (59%)
FES 356..376 CDD:197771 10/19 (53%)
NTHL1NP_002519.2 Nth 121..302 CDD:223255 105/181 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153126
Domainoid 1 1.000 169 1.000 Domainoid score I3814
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1897
Inparanoid 1 1.050 258 1.000 Inparanoid score I3148
Isobase 1 0.950 - 0 Normalized mean entropy S1129
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322642at2759
OrthoFinder 1 1.000 - - FOG0003205
OrthoInspector 1 1.000 - - oto89633
orthoMCL 1 0.900 - - OOG6_100563
Panther 1 1.100 - - LDO PTHR43286
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R847
SonicParanoid 1 1.000 - - X2154
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.880

Return to query results.
Submit another query.