DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9272 and Nthl1

DIOPT Version :9

Sequence 1:NP_610078.2 Gene:CG9272 / 35365 FlyBaseID:FBgn0032907 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001099198.1 Gene:Nthl1 / 29541 RGDID:1309289 Length:300 Species:Rattus norvegicus


Alignment Length:295 Identity:137/295 - (46%)
Similarity:176/295 - (59%) Gaps:22/295 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 EPLSPARVAPKKFRKDDRMVTRVQMGSATVVICKVVPDAVDSPVRVDKIREEVEPQIKQEAPEDS 146
            |.|:|...|.:. ||..:.|.|                    |.:..|:....|....:|..:..
  Rat    25 EELAPRETAAEG-RKSHKPVRR--------------------PRKKQKVHVAYEVANGEEGEDAE 68

  Fly   147 PSFSEVQAPHPLWFNHLENIRIMRNSRTAPVDTMGCHRCADLKADSKTQRFQNLVALMLSSQTKD 211
            |....|..|.. |...|.||||||:.:.||||.:|..:|.|:.|..|.:|:|.|::|||||||||
  Rat    69 PLKVPVWEPQN-WQQQLANIRIMRSKKDAPVDQLGAEQCYDITAPPKVRRYQVLLSLMLSSQTKD 132

  Fly   212 QTTYEAMNRLKDRGLTPLKVKEMPVTELENLLHPVSFYKNKAKYLKQTVEILTDKYGSDIPDNVK 276
            |.|..||.||:.||||...:.:.....|..|::||.|:::|.|::|||..||..:|..|||.:|.
  Rat   133 QVTAGAMQRLRARGLTVESILQTDDDLLGRLIYPVGFWRSKVKFIKQTTAILQQRYEGDIPASVA 197

  Fly   277 DLVALPGVGPKMAHICMAVAWNKITGIGVDVHVHRLSNRLGWVPKPTKEPEQTRVALEKWLPFSL 341
            :|||||||||||||:.|||||..::||.||.||||::|||.|..|.||.||:||..||:|||..|
  Rat   198 ELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLKWTKKMTKSPEETRRNLEEWLPRVL 262

  Fly   342 WSEVNHLFVGFGQTICTPVKPNCGECLNKDICPSA 376
            |||:|.|.|||||.||.||.|.|..||||.:||:|
  Rat   263 WSEINGLLVGFGQQICLPVHPRCQACLNKALCPAA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9272NP_610078.2 Nth 169..376 CDD:223255 115/206 (56%)
ENDO3c 205..355 CDD:214684 86/149 (58%)
FES 356..376 CDD:197771 12/19 (63%)
Nthl1NP_001099198.1 PRK10702 79..294 CDD:182661 119/215 (55%)
ENDO3c 126..275 CDD:214684 85/148 (57%)
FES 277..297 CDD:197771 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346740
Domainoid 1 1.000 162 1.000 Domainoid score I3907
eggNOG 1 0.900 - - E1_COG0177
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1897
Inparanoid 1 1.050 258 1.000 Inparanoid score I3067
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322642at2759
OrthoFinder 1 1.000 - - FOG0003205
OrthoInspector 1 1.000 - - oto96747
orthoMCL 1 0.900 - - OOG6_100563
Panther 1 1.100 - - LDO PTHR43286
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2154
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.