DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9272 and nth1

DIOPT Version :9

Sequence 1:NP_610078.2 Gene:CG9272 / 35365 FlyBaseID:FBgn0032907 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_593210.1 Gene:nth1 / 2543510 PomBaseID:SPAC30D11.07 Length:355 Species:Schizosaccharomyces pombe


Alignment Length:240 Identity:116/240 - (48%)
Similarity:141/240 - (58%) Gaps:12/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 PHPLWFNHLENIRIMRNSRTAPVDTMGCHRCADLKADSKTQRFQNLVALMLSSQTKDQTTYEAMN 219
            |...|....:.|..|:....||||..|||...: :.|.|..|||.||||||||||||......|.
pombe     8 PPENWREVYDEICKMKAKVVAPVDVQGCHTLGE-RNDPKKFRFQTLVALMLSSQTKDIVLGPTMR 71

  Fly   220 RLKDR---GLTPLKVKEMPVTELENLLHPVSFYKNKAKYLKQTVEILTDKYGSDIPDNVKDLVAL 281
            .||::   ||....::.:....|..|:..|.|:..|..||||...||::|:..||||.|:||:.|
pombe    72 NLKEKLAGGLCLEDIQNIDEVSLNKLIEKVGFHNRKTIYLKQMARILSEKFQGDIPDTVEDLMTL 136

  Fly   282 PGVGPKMAHICMAVAWNKITGIGVDVHVHRLSNRLGWVPKPTKEPEQTRVALEKWLPFSLWSEVN 346
            |||||||.::||::||||..||||||||||:.|.|.|.  .||..||||.||:.|||..||.|:|
pombe   137 PGVGPKMGYLCMSIAWNKTVGIGVDVHVHRICNLLHWC--NTKTEEQTRAALQSWLPKELWFELN 199

  Fly   347 HLFVGFGQTICTPVKPNCGECL--NKDICPSAHAE----TKEKRK 385
            |..||||||||.|....|..|.  :|.:||||..|    |..|||
pombe   200 HTLVGFGQTICLPRGRRCDMCTLSSKGLCPSAFKEKSGITITKRK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9272NP_610078.2 Nth 169..376 CDD:223255 106/211 (50%)
ENDO3c 205..355 CDD:214684 78/152 (51%)
FES 356..376 CDD:197771 8/21 (38%)
nth1NP_593210.1 Nth 21..236 CDD:223255 109/217 (50%)
ENDO3c 57..208 CDD:214684 78/152 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 142 1.000 Domainoid score I1189
eggNOG 1 0.900 - - E1_COG0177
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1897
Inparanoid 1 1.050 209 1.000 Inparanoid score I958
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003205
OrthoInspector 1 1.000 - - oto101089
orthoMCL 1 0.900 - - OOG6_100563
Panther 1 1.100 - - LDO PTHR43286
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R847
SonicParanoid 1 1.000 - - X2154
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.