DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9272 and nth-1

DIOPT Version :9

Sequence 1:NP_610078.2 Gene:CG9272 / 35365 FlyBaseID:FBgn0032907 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001369882.1 Gene:nth-1 / 187770 WormBaseID:WBGene00011201 Length:298 Species:Caenorhabditis elegans


Alignment Length:237 Identity:126/237 - (53%)
Similarity:155/237 - (65%) Gaps:7/237 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 EVQAPHPLWFNHLENIRIMRNSRTAPVDTMGCHRCADLKADSKTQRFQNLVALMLSSQTKDQTTY 215
            :|:.....|...:|.||.||....|||||||||:.||..|.....|||.||||||||||:|:...
 Worm    22 DVEGTVVAWRRDVELIRKMRKDMIAPVDTMGCHKLADPLAAPPVHRFQVLVALMLSSQTRDEVNA 86

  Fly   216 EAMNRLKDRGLTPLKVKEMPVTELENLLHPVSFYKNKAKYLKQTVEILTDKYGSDIPDNVKDLVA 280
            .||.||||.||:..|:.|..|.:||.:|.||.|||.||.||::|.:||.|.:..||||::..|.|
 Worm    87 AAMKRLKDHGLSIGKILEFKVPDLETILCPVGFYKRKAVYLQKTAKILKDDFSGDIPDSLDGLCA 151

  Fly   281 LPGVGPKMAHICMAVAWNKITGIGVDVHVHRLSNRLGWVPKPTKEPEQTRVALEKWLPFSLWSEV 345
            |||||||||::.|.:||.:..||.||.||||:||||||:  .|..||:|:.|||..||.|.|..:
 Worm   152 LPGVGPKMANLVMQIAWGECVGIAVDTHVHRISNRLGWI--KTSTPEKTQKALEILLPKSEWQPI 214

  Fly   346 NHLFVGFGQTICTPVKPNCGECLNKDICPSAHA-----ETKE 382
            |||.|||||..|.||:|.||.||.:..|||:.|     ||:|
 Worm   215 NHLLVGFGQMQCQPVRPKCGTCLCRFTCPSSTAKNVKSETEE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9272NP_610078.2 Nth 169..376 CDD:223255 116/206 (56%)
ENDO3c 205..355 CDD:214684 83/149 (56%)
FES 356..376 CDD:197771 10/19 (53%)
nth-1NP_001369882.1 Nth 39..244 CDD:223255 115/206 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162781
Domainoid 1 1.000 153 1.000 Domainoid score I2630
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1897
Inparanoid 1 1.050 243 1.000 Inparanoid score I2082
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322642at2759
OrthoFinder 1 1.000 - - FOG0003205
OrthoInspector 1 1.000 - - oto18023
orthoMCL 1 0.900 - - OOG6_100563
Panther 1 1.100 - - LDO PTHR43286
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R847
SonicParanoid 1 1.000 - - X2154
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.930

Return to query results.
Submit another query.