DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nthl1 and Nthl1

DIOPT Version :10

Sequence 1:NP_610078.2 Gene:Nthl1 / 35365 FlyBaseID:FBgn0032907 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_032769.2 Gene:Nthl1 / 18207 MGIID:1313275 Length:300 Species:Mus musculus


Alignment Length:179 Identity:38/179 - (21%)
Similarity:65/179 - (36%) Gaps:34/179 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DGLHVDEFKSI-TKQVCKL-------PSF----LSPALFRKIDPNCTDIVTRDAFIKYWID---- 59
            ||    |||.: .::|.:|       ||.    ||.||....|.|....|....|:..::.    
Mouse    30 DG----EFKLLQAEEVARLWGARKNKPSMNYDKLSRALRYYYDKNIIKKVNGQKFVYRFVSYPDI 90

  Fly    60 --GNMLT----MDTASQIYNILRQQGCSYLRQADFKPVLDELLATHPGLEFLRTISEFQERYAET 118
              |:::.    .|..|.....|..|..:..|..|.|.:::....|     ..::.|..:..|..:
Mouse    91 LKGDVMARAEGADGGSNGPLPLSDQPTNISRDKDNKSIIERGAGT-----LAQSKSSSRNEYIHS 150

  Fly   119 VIYRIFYYIN-RSGTGCL--TLRELRRGNLIAAMQQLDEEDDINKIIRY 164
            .:|..|...: :|||...  |..|.....|:......|....::.:|::
Mouse   151 GLYTSFTLTSLQSGTQLFKATKNENPGEKLMEKKSTQDSPQPLSTVIKF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nthl1NP_610078.2 Nth 197..376 CDD:439947
Nthl1NP_032769.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 10/34 (29%)
Nth 118..298 CDD:439947 12/69 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.