DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPA2 and RPA2

DIOPT Version :9

Sequence 1:NP_001260652.1 Gene:RPA2 / 35364 FlyBaseID:FBgn0032906 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001118376.1 Gene:RPA2 / 816985 AraportID:AT2G24490 Length:279 Species:Arabidopsis thaliana


Alignment Length:279 Identity:66/279 - (23%)
Similarity:123/279 - (44%) Gaps:52/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NDSF--GDFNATQ-----TAPTGAASNQKGEGIVPLVVKQIVD-----APEGNIELFGMQYAMAC 54
            |..|  |.|.::|     .:.:..|.|:..:|:||:.||||.:     ..:..:.:.|:......
plant    10 NSGFSGGGFMSSQPSQAYESSSSTAKNRDFQGLVPVTVKQITECFQSSGEKSGLVINGISLTNVS 74

  Fly    55 VVAIVRNVETSS-TKITYTLEDHSGRIDAHYWLEEG-DALKAPEVMVNNYVKVYGTTRSQGGSKT 117
            :|.:|.:.:.|. |::.:||:|.:||||...|:.|. ||.:...|....||::.|..::..|...
plant    75 LVGLVCDKDESKVTEVRFTLDDGTGRIDCKRWVSETFDAREMESVRDGTYVRLSGHLKTFQGKTQ 139

  Fly   118 LMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQSKGGAGAGAGASSGSGSIADFTASQSSAIVSG 182
            |::|.:.|::|.|||..|.:|.::...:..:.|.:              .:.|.|.|.::....|
plant   140 LLVFSVRPIMDFNEVTFHYIECIHFYSQNSESQRQ--------------QVGDVTQSVNTTFQGG 190

  Fly   183 LEPKQQAVFQAIKSNVSEEGISRKEL---------------KAKFSHISD---------SELTNI 223
            ....|..:...:.|:.:.:|..||.|               :.:..||.:         ::|..:
plant   191 SNTNQATLLNPVVSSQNNDGNGRKNLDDMILDYLKQPACTARQQGIHIDEIAQQLKIPKNKLEGV 255

  Fly   224 LDFMISEGHIYSSIDADHF 242
            :..:..:|.|||:||..||
plant   256 VQSLEGDGLIYSTIDEYHF 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPA2NP_001260652.1 RFA2 12..246 CDD:227560 62/267 (23%)
RPA2_DBD_D 52..144 CDD:239924 29/93 (31%)
RPA_C <182..238 CDD:285937 14/79 (18%)
RPA2NP_001118376.1 RPA2_DBD_D 72..165 CDD:239924 28/94 (30%)
RPA_C 163..272 CDD:400920 21/112 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5235
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37712
Inparanoid 1 1.050 79 1.000 Inparanoid score I2383
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D924826at2759
OrthoFinder 1 1.000 - - FOG0003638
OrthoInspector 1 1.000 - - otm3452
orthoMCL 1 0.900 - - OOG6_102423
Panther 1 1.100 - - O PTHR13989
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.