DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPA2 and STN1

DIOPT Version :9

Sequence 1:NP_001260652.1 Gene:RPA2 / 35364 FlyBaseID:FBgn0032906 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_079204.2 Gene:STN1 / 79991 HGNCID:26200 Length:368 Species:Homo sapiens


Alignment Length:262 Identity:45/262 - (17%)
Similarity:88/262 - (33%) Gaps:58/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LVVKQIVDAPEG----NIELF-GMQYAMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYW--LE 87
            |.::.|:|..|.    .:.|: |.......|:..|..|.......:|.::|.:|.|:...|  |.
Human    29 LYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLN 93

  Fly    88 EGDALKAP-----------------------EVMVNNYVKVYGTTRSQGGSKTLMIFKLLPVLDP 129
            ......||                       ::.:.:.::|.|:.|:....:.:.......|.||
Human    94 TESVSAAPSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDP 158

  Fly   130 --NEVCTHLLEVLNARYRAEDYQSKGGAGAGAGASSGSG-----SIADFTASQSSAIVSGLEPKQ 187
              |.....:||:.....:..|......|.....|.|..|     |:....:.::...:  :|.:.
Human   159 VWNIQIARMLELPTIYRKVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFL--MENRV 221

  Fly   188 QAVFQ----------------AIKSNVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSS 236
            |:.:|                .|.|..|::...:|:..:|..|   |...|.:..:..:|.::..
Human   222 QSFYQQELEMVESLLSLANQPVIHSASSDQVNFKKDTTSKAIH---SIFKNAIQLLQEKGLVFQK 283

  Fly   237 ID 238
            .|
Human   284 DD 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPA2NP_001260652.1 RFA2 12..246 CDD:227560 45/262 (17%)
RPA2_DBD_D 52..144 CDD:239924 20/118 (17%)
RPA_C <182..238 CDD:285937 12/71 (17%)
STN1NP_079204.2 Interaction with CTC1. /evidence=ECO:0000269|PubMed:23851344 1..185 27/155 (17%)
hOBFC1_like 58..155 CDD:239929 14/96 (15%)
STN1_2 157..334 CDD:286279 24/134 (18%)
Winged helix-turn-helix (wHTH) 1 191..295 17/100 (17%)
Winged helix-turn-helix (wHTH) 2 296..368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5235
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.