DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPA2 and rpa2

DIOPT Version :9

Sequence 1:NP_001260652.1 Gene:RPA2 / 35364 FlyBaseID:FBgn0032906 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001006795.1 Gene:rpa2 / 448500 XenbaseID:XB-GENE-487430 Length:275 Species:Xenopus tropicalis


Alignment Length:253 Identity:81/253 - (32%)
Similarity:134/253 - (52%) Gaps:20/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GDFNATQTAPTGA--ASNQKGEGIVPLVVKQIVDAPEGNIELFGM---QYAMACVVAIVRNVETS 65
            |.|.:  .|||..  .|..:.:.|||..|.|::.|.: |.|:|.:   :.:...:|.|||:.|.:
 Frog    27 GGFGS--PAPTQGEKKSRSRSQQIVPCTVSQLLSATQ-NDEMFRIGEAELSQVTIVGIVRHAEKA 88

  Fly    66 STKITYTLEDHSGR-IDAHYWLEEGDALKAPEVMV---NNYVKVYGTTRSQGGSKTLMIFKLLPV 126
            .|.|.|.::|.:.. :|...|::..:|  :.|.||   .:||||.|..||....|:::.||:.||
 Frog    89 PTNILYKVDDMTAAPMDVRQWVDTDEA--SCENMVVPPGSYVKVAGHLRSFQNKKSVVAFKIAPV 151

  Fly   127 LDPNEVCTHLLEVLNARYRAEDYQSKGGAGAGAGASSGSGSIAD----FTASQSSAIVSGLEPKQ 187
            .|.||..:|:|||::|........:..|.|: |.|.:..|.:.|    |:....:| .:||.|.|
 Frog   152 DDMNEFVSHMLEVVHAHMTMNSQGAPSGGGS-AVALNTPGRLGDSGGAFSGGNDNA-TNGLTPHQ 214

  Fly   188 QAVFQAIKSNVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICT 245
            ..:...|||....||::.:|||.:...::.:.:...:||:.:||||||::|.:|:..|
 Frog   215 SQILNLIKSFKGNEGMAFEELKNRLHGMNVNTIRQAVDFLSNEGHIYSTVDDEHYKST 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPA2NP_001260652.1 RFA2 12..246 CDD:227560 79/247 (32%)
RPA2_DBD_D 52..144 CDD:239924 35/95 (37%)
RPA_C <182..238 CDD:285937 20/55 (36%)
rpa2NP_001006795.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..47 6/21 (29%)
RFA2 27..272 CDD:227560 80/251 (32%)
RPA2_DBD_D 75..169 CDD:239924 35/95 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9576
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37712
Inparanoid 1 1.050 112 1.000 Inparanoid score I4721
OMA 1 1.010 - - QHG58029
OrthoDB 1 1.010 - - D561832at33208
OrthoFinder 1 1.000 - - FOG0003638
OrthoInspector 1 1.000 - - otm49518
Panther 1 1.100 - - LDO PTHR13989
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1086
SonicParanoid 1 1.000 - - X4625
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.