DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RPA2 and stn1

DIOPT Version :9

Sequence 1:	NP_001260652.1	Gene:	RPA2 / 35364	FlyBaseID:	FBgn0032906	Length:	246	Species:	Drosophila melanogaster
Sequence 2:	NP_956683.1	Gene:	stn1 / 393360	ZFINID:	ZDB-GENE-040426-1390	Length:	368	Species:	Danio rerio

Alignment Length:	90	Identity:	17/90 - (18%)
Similarity:	33/90 - (36%)	Gaps:	31/90 - (34%)

- Green bases have known domain annotations that are detailed below.

  Fly    71 YTLEDHSGRIDAHYWLEE-----------GDA--------------------LKAPEVMVNNYVK 104
            |.::|.:|.|:...|.:|           |||                    ||:..:.:.:.::
Zfish    76 YGVDDSTGVINCLCWKDEKWRDQGGSTTCGDASGFPRSFNIEDELKGLKEAELKSTVLEIGDLLR 140

  Fly   105 VYGTTRSQGGSKTLMIFKLLPVLDP 129
            |.||.::...::.:.......|.||
Zfish   141 VRGTVKTSRDNREIKATSFYKVHDP 165

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RPA2	NP_001260652.1	RFA2	12..246	CDD:227560	17/90 (19%)
		RPA2_DBD_D	52..144	CDD:239924	17/90 (19%)
		RPA_C	<182..238	CDD:285937
stn1	NP_956683.1	Interaction with CTC1. /evidence=ECO:0000250\|UniProtKB:Q9H668	2..192		17/90 (19%)
		hOBFC1_like	59..162	CDD:239929	14/85 (16%)
		STN1_2	164..334	CDD:286279	2/2 (100%)
		Winged helix-turn-helix (wHTH) 1. /evidence=ECO:0000250	201..295
		Winged helix-turn-helix (wHTH) 2. /evidence=ECO:0000250	296..368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5235
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900