DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPA2 and Stn1

DIOPT Version :9

Sequence 1:NP_001260652.1 Gene:RPA2 / 35364 FlyBaseID:FBgn0032906 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001011943.1 Gene:Stn1 / 294025 RGDID:1305637 Length:408 Species:Rattus norvegicus


Alignment Length:259 Identity:44/259 - (16%)
Similarity:86/259 - (33%) Gaps:58/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LVVKQIVDAPEGNIELFGMQY------AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEE 88
            |.:|.|::..|.. ::.||.:      ....::..|.:|:...|..:|.::|.:|.|:...|...
  Rat    36 LYIKDILEMKESQ-QVPGMYFYNGHPIRRVDIMGAVISVKERETFYSYGVDDATGVINCVCWKRP 99

  Fly    89 GDALKA--PEVM--------------------------VNNYVKVYGTTRSQGGSKTLMIFKLLP 125
            .:|..:  |.::                          :.:.::|.|..|.....:.:.......
  Rat   100 SNAESSSDPAILSTSRELSMTSQLKKLQETIEQKTKIGIGDIIRVRGYVRMFREEREICATIYYK 164

  Fly   126 VLDP--NEVCTHLLEVLNARYRAEDYQSKGGAGAGAGA--SSGSGSIADFTASQSSAI------- 179
            |.||  |.....:||:.....:..|...:..|.....|  |..:..:|..||..|..:       
  Rat   165 VDDPVWNMQIARMLELPELYKKVYDQPFRNPALKEEEALNSKDTLDLAGLTALLSEKVKEFLQEK 229

  Fly   180 ---------VSGLEPKQQAVFQAIKSNVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIY 234
                     :..:||.|....|.:..:...:.:..|...|...|   |...|.|..:..:|.::
  Rat   230 KVQSFYQKELEMVEPLQSLASQPVTHSTCSDQVELKNDAASDIH---SVFKNALHLLQEKGFVF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPA2NP_001260652.1 RFA2 12..246 CDD:227560 44/259 (17%)
RPA2_DBD_D 52..144 CDD:239924 19/121 (16%)
RPA_C <182..238 CDD:285937 11/53 (21%)
Stn1NP_001011943.1 Interaction with CTC1. /evidence=ECO:0000250|UniProtKB:Q9H668 8..195 26/159 (16%)
hOBFC1_like 65..165 CDD:239929 13/99 (13%)
STN1_2 167..374 CDD:286279 24/127 (19%)
Winged helix-turn-helix (wHTH) 1. /evidence=ECO:0000250 201..304 17/93 (18%)
Winged helix-turn-helix (wHTH) 1. /evidence=ECO:0000250 305..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5235
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.