DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPA2 and Stn1

DIOPT Version :9

Sequence 1:NP_001260652.1 Gene:RPA2 / 35364 FlyBaseID:FBgn0032906 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_780569.1 Gene:Stn1 / 108689 MGIID:1915581 Length:378 Species:Mus musculus


Alignment Length:270 Identity:50/270 - (18%)
Similarity:97/270 - (35%) Gaps:54/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LVVKQIVDAPE-----GNIELFGMQYAMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYW--LE 87
            |.:|.|::..|     |.....|.......::..|.:|:...|..:|.::|.:|.|:...|  |.
Mouse    36 LYIKDILEMKESQQVPGTYFYNGHPIRRVDIMGAVISVKERETFYSYGVDDATGVINCVCWKKLS 100

  Fly    88 EGDALKAPEVM--------------------------VNNYVKVYGTTRSQGGSKTLMIFKLLPV 126
            ..::...|.::                          :.:.::|.|:.|.....:.:.......|
Mouse   101 NAESSSDPAILSTARELSMTSQLKKLQETIEQKTRIGIGDIIRVRGSVRMFREEREICANIYYKV 165

  Fly   127 LDP--NEVCTHLLEVLNARYRAEDYQSKGGAGAGAGASSGSGS--IADFTASQSSAIVSGL-EPK 186
            .||  |.....:||:.....:..|...:..|.....|.:...:  :|..|:..|..|...| |.|
Mouse   166 DDPVWNMQIARMLELPKLYQKVYDQPFRNPALQEEEALNNKDNLDLAGLTSLLSEKIKEFLQEKK 230

  Fly   187 QQAVFQ-------AIKSNVS-----EEGISRKELK-AKFSHISDSELTNILDFMISEGHIY---S 235
            .|:.:|       :::|..|     ..|..:.||| :..|.::.....|.|..:..:|.::   |
Mouse   231 MQSFYQQELETVESLQSLASRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQEKGLVFQRDS 295

  Fly   236 SIDADHFICT 245
            ..|..:::.|
Mouse   296 GSDKLYYVTT 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPA2NP_001260652.1 RFA2 12..246 CDD:227560 50/270 (19%)
RPA2_DBD_D 52..144 CDD:239924 19/121 (16%)
RPA_C <182..238 CDD:285937 16/72 (22%)
Stn1NP_780569.1 Interaction with CTC1. /evidence=ECO:0000250|UniProtKB:Q9H668 8..195 26/158 (16%)
hOBFC1_like 65..165 CDD:239929 13/99 (13%)
STN1_2 167..343 CDD:370338 30/139 (22%)
Winged helix-turn-helix (wHTH) 1. /evidence=ECO:0000250 201..305 22/103 (21%)
Winged helix-turn-helix (wHTH) 2. /evidence=ECO:0000250 306..378 50/270 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5235
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.