DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sky and AT4G39870

DIOPT Version :9

Sequence 1:NP_001260649.1 Gene:sky / 35359 FlyBaseID:FBgn0032901 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001190974.1 Gene:AT4G39870 / 830146 AraportID:AT4G39870 Length:394 Species:Arabidopsis thaliana


Alignment Length:171 Identity:45/171 - (26%)
Similarity:83/171 - (48%) Gaps:19/171 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 TLWSWLPVRITMYQPVLLYTTEEHGCSLTTFYVRVEQHEP--TLLMIKTCNNEVFGAYCSSRWFE 499
            :|::.||..:...:.:|||:|..||.||:|.| |.....|  :||::......|||....:....
plant   218 SLYTSLPALVQGRKWILLYSTWRHGISLSTLY-RKSLLWPGLSLLVVGDRKGSVFGGLVEAPLIP 281

  Fly   500 RNVKDDKGQRQAYFGTGETFLFSLYPERAKYPWVGIEGDKDLGHSSELFMAADSKMITIGGGEGQ 564
            .:.|        |.||..||:|:   .::..|.:    .:..| ::..:.....:.:.:|||...
plant   282 TDKK--------YQGTNSTFVFT---NKSGQPTI----YRPTG-ANRFYTLCSKEFLALGGGGRF 330

  Fly   565 AIWMDENIRFGKTDSCKTFNNPPLCPSGDFEIRVLEVYGFV 605
            |:::|..:..|.:...:|:.|..|..|.||:::.:|::|||
plant   331 ALYLDSELLSGSSAYSETYGNSCLADSQDFDVKEVELWGFV 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
skyNP_001260649.1 RabGAP-TBC 82..293 CDD:382990
TLDc 431..605 CDD:214733 43/169 (25%)
AT4G39870NP_001190974.1 TLD 236..370 CDD:284865 37/150 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.