DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sky and Meak7

DIOPT Version :10

Sequence 1:NP_001260649.1 Gene:sky / 35359 FlyBaseID:FBgn0032901 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_083159.1 Gene:Meak7 / 74347 MGIID:1921597 Length:455 Species:Mus musculus


Alignment Length:37 Identity:11/37 - (29%)
Similarity:18/37 - (48%) Gaps:2/37 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 AGDLSYADDHPNHDQSKWDSYGRFVEPSAAYQPWIWA 187
            |.|...|....|::..|::..|.|:|  ..|.|:.:|
Mouse   356 ACDRLKAHGKKNYELVKYEKAGHFIE--VPYMPFCFA 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
skyNP_001260649.1 TBC 82..293 CDD:214540 11/37 (30%)
TLDc 431..605 CDD:214733
Meak7NP_083159.1 TLDc 242..410 CDD:214733 11/37 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 435..455
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.