DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sky and si:ch211-15d5.11

DIOPT Version :9

Sequence 1:NP_001260649.1 Gene:sky / 35359 FlyBaseID:FBgn0032901 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_005158594.1 Gene:si:ch211-15d5.11 / 559575 ZFINID:ZDB-GENE-131121-177 Length:654 Species:Danio rerio


Alignment Length:165 Identity:57/165 - (34%)
Similarity:82/165 - (49%) Gaps:20/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 LPVRITMYQPVLLYTTEEHGCSLTTFYVRVEQHE-PTLLMIKTCNNEVFGAYCSSRWFERNVKDD 505
            ||.|...|...|.|:|::||.||.|.|.::...: |.|::||..|.:|||::.|......:    
Zfish   507 LPPRTIGYTWQLSYSTDKHGASLKTLYRKLSATDSPVLILIKDHNQQVFGSFLSHPLHPSD---- 567

  Fly   506 KGQRQAYFGTGETFLFSLYPERAKYPWVGIEGDKDLGHSSELFMAADSKMITIGGGEGQ-AIWMD 569
                 |::||||||||..:|....:.|.|         .:..|:..|.....||||.|. .:|:|
Zfish   568 -----AFYGTGETFLFLSHPRFKCFKWTG---------ENSFFIKGDLDSFAIGGGSGHFGLWVD 618

  Fly   570 ENIRFGKTDSCKTFNNPPLCPSGDFEIRVLEVYGF 604
            |.:..|::..|.||||..|..:.||.|..||.:.|
Zfish   619 ERLFLGRSSPCFTFNNCSLSETNDFTILDLEAWTF 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
skyNP_001260649.1 RabGAP-TBC 82..293 CDD:382990
TLDc 431..605 CDD:214733 57/165 (35%)
si:ch211-15d5.11XP_005158594.1 TLDc 494..654 CDD:214733 57/165 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.