DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sky and Tldc2

DIOPT Version :10

Sequence 1:NP_001260649.1 Gene:sky / 35359 FlyBaseID:FBgn0032901 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_006499899.1 Gene:Tldc2 / 383766 MGIID:2686178 Length:261 Species:Mus musculus


Alignment Length:163 Identity:55/163 - (33%)
Similarity:85/163 - (52%) Gaps:20/163 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 LPVRITMYQPVLLYTTEEHGCSLTTFYVRVEQHE-PTLLMIKTCNNEVFGAYCSSRWFERNVKDD 505
            ||.|:|.:...|::.|...|.||...|.::|.|. |.||:::..:.::|||:.||.     ::..
Mouse   114 LPPRVTGHPWSLVFCTSRDGFSLRRLYRQMEGHSGPVLLLLRDQDGQMFGAFSSSA-----IRLS 173

  Fly   506 KGQRQAYFGTGETFLFSLYPERAKYPWVGIEGDKDLGHSSELFMAADSKMITIGGGEGQ-AIWMD 569
            ||    ::|||||||||..|:...:.|.        ||:| .|:..|...:.:|.|.|| .:|:|
Mouse   174 KG----FYGTGETFLFSFSPQLKVFKWT--------GHNS-FFVKGDLDSLMMGSGSGQFGLWLD 225

  Fly   570 ENIRFGKTDSCKTFNNPPLCPSGDFEIRVLEVY 602
            .::..|.:..|.||||..|.....|.|:.||.:
Mouse   226 GDLYHGGSYPCATFNNEVLARREQFCIKELEAW 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
skyNP_001260649.1 TBC 82..293 CDD:214540
TLDc 431..605 CDD:214733 55/163 (34%)
Tldc2XP_006499899.1 TLDc 115..261 CDD:214733 54/162 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.