DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sky and TLDC2

DIOPT Version :9

Sequence 1:NP_001260649.1 Gene:sky / 35359 FlyBaseID:FBgn0032901 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_542195.1 Gene:TLDC2 / 140711 HGNCID:16112 Length:215 Species:Homo sapiens


Alignment Length:178 Identity:55/178 - (30%)
Similarity:88/178 - (49%) Gaps:20/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 SQACKNEDLFTLWSWLPVRITMYQPVLLYTTEEHGCSLTTFYVRVEQ-HEPTLLMIKTCNNEVFG 490
            ||.....::..|....|.|:|.:...|::.|...|.||.:.|.|:|. ..|.||:::..:.::||
Human    53 SQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQIFG 117

  Fly   491 AYCSSRWFERNVKDDKGQRQAYFGTGETFLFSLYPERAKYPWVGIEGDKDLGHSSELFMAADSKM 555
            |:.||.     ::..||    ::|||||||||..|:...:.|.|         |:..|:..|...
Human   118 AFSSSA-----IRLSKG----FYGTGETFLFSFSPQLKVFKWTG---------SNSFFVKGDLDS 164

  Fly   556 ITIGGGEGQ-AIWMDENIRFGKTDSCKTFNNPPLCPSGDFEIRVLEVY 602
            :.:|.|.|: .:|:|.::..|.:..|.||||..|.....|.|:.||.:
Human   165 LMMGSGSGRFGLWLDGDLFRGGSSPCPTFNNEVLARQEQFCIQELEAW 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
skyNP_001260649.1 RabGAP-TBC 82..293 CDD:382990
TLDc 431..605 CDD:214733 53/174 (30%)
TLDC2NP_542195.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
TLDc 53..212 CDD:214733 55/176 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.