DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14401 and CG9336

DIOPT Version :9

Sequence 1:NP_001246115.1 Gene:CG14401 / 35358 FlyBaseID:FBgn0032900 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_610069.2 Gene:CG9336 / 35355 FlyBaseID:FBgn0032897 Length:148 Species:Drosophila melanogaster


Alignment Length:154 Identity:53/154 - (34%)
Similarity:73/154 - (47%) Gaps:13/154 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VNTIYCESVNLGFYRLFCGKLFTRAITCYECDSVNNPGCGERFVGDDISTTDCDVVANMRSLG-- 112
            |:.:.|.........|.|.   ..||.||:|:|:..|.||.:|..|:....||..:...|.|.  
  Fly     2 VSALKCSLAVAVMISLACS---AYAIKCYQCESLTMPKCGLKFEADETLLLDCSRIGPPRYLQNF 63

  Fly   113 ---AEAT-CLTKYHEGMPGDTRFVRRSCYFGDASPIGVSCDDGPDPVVPFMNFLGCTLCDTDLCN 173
               ..|| |:.|..|.:.|..:.| |||||||.:.|...|..  ||.:||:..|||.:|..|.||
  Fly    64 FPLRNATGCMKKTLESVAGHPQIV-RSCYFGDINNIQAGCQS--DPSMPFVKQLGCDVCTKDECN 125

  Fly   174 AAAGLSTLPLVIALSILGLLVLLA 197
            .::.|:.:...|.| ..|:..|||
  Fly   126 GSSSLAPIAGAILL-FFGVARLLA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14401NP_001246115.1 None
CG9336NP_610069.2 QVR 24..125 CDD:407231 39/103 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012691
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.