DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14401 and CG31676

DIOPT Version :9

Sequence 1:NP_001246115.1 Gene:CG14401 / 35358 FlyBaseID:FBgn0032900 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001286113.1 Gene:CG31676 / 35351 FlyBaseID:FBgn0051676 Length:159 Species:Drosophila melanogaster


Alignment Length:145 Identity:39/145 - (26%)
Similarity:61/145 - (42%) Gaps:24/145 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LGFYRLFCGKLFTRA---ITCYEC--DSVNNPGCGERFVGDDIST-------TDCDVVANMRSLG 112
            ||.:.|.  .:|..|   :.|:.|  |..|...|.:.|:.:.||.       .:|......:|:.
  Fly    11 LGLFSLL--MVFNTASAVLRCWRCSTDVSNGEFCNDPFMPETISEQQRYWSYVNCTYSVGAKSVN 73

  Fly   113 AEATCLTKYHEGMPGDTRFVRRSCYFGDASPIGVSCDDGPDPVVPFMNFLGCTLCDTDLCNAAAG 177
            |...| .|..:.:.| .|.:.|||::.|.......|.:  |....::..:.|..|.||.||.|:|
  Fly    74 ARPVC-KKLVQEVYG-KRVISRSCFYEDMDDSADKCAN--DQTSSYIKTVYCRTCTTDGCNGASG 134

  Fly   178 ------LSTLPLVIA 186
                  |..|||::|
  Fly   135 ATPRVLLLMLPLLLA 149



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.