Sequence 1: | NP_001246115.1 | Gene: | CG14401 / 35358 | FlyBaseID: | FBgn0032900 | Length: | 198 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_609557.1 | Gene: | crok / 34646 | FlyBaseID: | FBgn0032421 | Length: | 151 | Species: | Drosophila melanogaster |
Alignment Length: | 141 | Identity: | 43/141 - (30%) |
---|---|---|---|
Similarity: | 65/141 - (46%) | Gaps: | 16/141 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 LFCGKLFTRAITCYECDSVNNPGCGERFVGDDISTTDCDVVANMRSL-GAEATCLTKYHEGMPGD 128
Fly 129 TRFVRRSCYFGDASPIGVSCDD-------GPDPVVPFMNFLGCTLCDTDLCNAAAGLSTLPLVIA 186
Fly 187 LSILGLLVLLA 197 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR33562 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |