DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14401 and witty

DIOPT Version :10

Sequence 1:NP_001246115.1 Gene:CG14401 / 35358 FlyBaseID:FBgn0032900 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_609212.2 Gene:witty / 34145 FlyBaseID:FBgn0032023 Length:187 Species:Drosophila melanogaster


Alignment Length:167 Identity:41/167 - (24%)
Similarity:55/167 - (32%) Gaps:50/167 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 AITCYECDSVNNPGCGERFVGDDISTTDCDVVANMRSLGAEATCLTKYHEGMPG----------- 127
            ||.||.|||.:||.|.:......|...:| .:..|:||......|.|:.....|           
  Fly    19 AIRCYVCDSSDNPSCADLGSNSSIVAEEC-TLDKMKSLDTWLFDLNKFSYFDNGANKSPLMNCQK 82

  Fly   128 ------DTRFV--RRSCYF----GDASPI-------------------------GVSCDDGPDPV 155
                  |||.|  .|.|..    .||..|                         |...|...|..
  Fly    83 VVAKDPDTRKVVTARFCQLDTGDSDACEILRTKLRIPSPEEREQRNRNQNKRRKGHGQDAEEDDE 147

  Fly   156 VPFMNFLGCTLCDTDLCNAAAGLSTLPLVIALSILGL 192
            :...:...|.:|.:..||.||.: ||.|...|:::.|
  Fly   148 ISAEDAFFCGICKSHRCNGAAAV-TLSLATILAMIAL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14401NP_001246115.1 TFP 74..175 CDD:480272 34/148 (23%)
wittyNP_609212.2 TFP 18..>51 CDD:480272 12/32 (38%)

Return to query results.
Submit another query.