DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9338 and crim

DIOPT Version :10

Sequence 1:NP_610071.1 Gene:CG9338 / 35357 FlyBaseID:FBgn0032899 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_648500.1 Gene:crim / 39321 FlyBaseID:FBgn0036198 Length:158 Species:Drosophila melanogaster


Alignment Length:177 Identity:40/177 - (22%)
Similarity:55/177 - (31%) Gaps:64/177 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILALTVLATVACTGYAIKCYQCDSLT---------------NSECGK--DIKSDSSLVLDCTKMA 55
            ::|..:||.:...|.||.||:|.|.|               ...|.:  ||         |.|:.
  Fly     7 LIAALLLAALIHEGSAIWCYRCTSATPGCAEKFNWRGIGFLGEHCPEPDDI---------CVKVT 62

  Fly    56 PPRFLQNFFPVRNATGCMKQTIDIPGNPQIVRSCYFGNIADTKVGCQTDPSLTINKLLS------ 114
            ..|..:... .|:....:....|||              ||...||:  |:....||.:      
  Fly    63 ERRGARETI-TRDCLSALSFRKDIP--------------ADKYEGCR--PAAHDEKLANYVNHTI 110

  Fly   115 ---------------CEVCTEDECNGTSSLAPIAGVILLFFGLARLL 146
                           |....:..|||.|.|...|.:.||....|.||
  Fly   111 KEHDVRRDYYTDTTFCFCFLDHRCNGASGLQTSAVIGLLTLIPALLL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9338NP_610071.1 TFP 23..125 CDD:480272 26/139 (19%)
crimNP_648500.1 TFP_LU_ECD_Crim 21..137 CDD:467120 27/141 (19%)

Return to query results.
Submit another query.