DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9338 and CG14274

DIOPT Version :9

Sequence 1:NP_001260646.1 Gene:CG9338 / 35357 FlyBaseID:FBgn0032899 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_609212.2 Gene:CG14274 / 34145 FlyBaseID:FBgn0032023 Length:187 Species:Drosophila melanogaster


Alignment Length:190 Identity:51/190 - (26%)
Similarity:72/190 - (37%) Gaps:62/190 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MILALTVLATVACTGYAIKCYQCDSLTNSECGKDIKSDSSLVL-DCT--KMAP--------PRFL 60
            ::|.|.:||.|: .|.||:||.|||..|..|. |:.|:||:|. :||  ||..        .:| 
  Fly     4 ILLPLALLALVS-NGAAIRCYVCDSSDNPSCA-DLGSNSSIVAEECTLDKMKSLDTWLFDLNKF- 65

  Fly    61 QNFF-------PVRNATGCMKQTIDIPGNPQIV--RSCYFG-------NIADTKV---------- 99
             ::|       |:.|   |.|.....|...::|  |.|...       .|..||:          
  Fly    66 -SYFDNGANKSPLMN---CQKVVAKDPDTRKVVTARFCQLDTGDSDACEILRTKLRIPSPEEREQ 126

  Fly   100 --------------GCQTDPSLTINKLLSCEVCTEDECNG----TSSLAPIAGVILLFFG 141
                          ..:.|..::......|.:|....|||    |.|||.|..:|.|..|
  Fly   127 RNRNQNKRRKGHGQDAEEDDEISAEDAFFCGICKSHRCNGAAAVTLSLATILAMIALQLG 186



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147170at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.