DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9338 and CG31675

DIOPT Version :10

Sequence 1:NP_610071.1 Gene:CG9338 / 35357 FlyBaseID:FBgn0032899 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_724298.1 Gene:CG31675 / 318879 FlyBaseID:FBgn0051675 Length:148 Species:Drosophila melanogaster


Alignment Length:144 Identity:55/144 - (38%)
Similarity:82/144 - (56%) Gaps:5/144 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILALTVLATVACTGYAIKCYQCDSLTNSECGKDIKSDSSLVLDCTKMAPPRFLQNFFPVRNATGC 72
            :|....|.::..:.||||||.|:|:..:.||.|.:.::....||..:||||||:|.....|||.|
  Fly     5 LLLFGALISLLASAYAIKCYACESVYEASCGDDFEVENHFKYDCAFIAPPRFLENDLLSVNATAC 69

  Fly    73 MKQTIDIPGNPQIVRSCYFGNIADTKVGCQTDPSLTINKLLSCEVC-TEDECNGTSSLA----PI 132
            :|:.....|..:|||.||||.:..|.|.|:.||:|:..:..||.|| :|:.|||:.:..    .|
  Fly    70 LKRVFKENGVRKIVRGCYFGEVNATDVWCKMDPTLSAVQNSSCHVCDSENYCNGSENHPVDKWKI 134

  Fly   133 AGVILLFFGLARLL 146
            .|.::||....:||
  Fly   135 FGSLVLFLLATQLL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9338NP_610071.1 TFP 23..125 CDD:480272 44/102 (43%)
CG31675NP_724298.1 TFP 20..124 CDD:480272 45/103 (44%)

Return to query results.
Submit another query.