DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9338 and C15H9.9

DIOPT Version :10

Sequence 1:NP_610071.1 Gene:CG9338 / 35357 FlyBaseID:FBgn0032899 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_509029.1 Gene:C15H9.9 / 180885 WormBaseID:WBGene00015803 Length:137 Species:Caenorhabditis elegans


Alignment Length:143 Identity:41/143 - (28%)
Similarity:49/143 - (34%) Gaps:49/143 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALTVLATVACTGYAIKCYQCDSLTNSECGKDIKSDSSLVL---DCTKMAPPRFLQNFFPVRNAT 70
            |||.|.|.       |.||||.|..|..|  |...|.:|..   .||.:....|..|     .|.
 Worm    12 LALGVSAN-------ISCYQCTSNENPTC--DANDDGALEAFKKTCTPLTEGTFKGN-----AAV 62

  Fly    71 GCMKQTIDIPGNPQIVRSC-YFGNIAD--TKVG----------CQTDPSLTINKLLSCEVCTEDE 122
            ||.|.|..:.|...:||.| |.|...|  .|.|          |:.:.:.|             .
 Worm    63 GCRKITQSVEGVLSVVRECAYSGEPVDGLKKTGNHAIRIHYYQCENEKAGT-------------P 114

  Fly   123 CNGTSSLAPIAGV 135
            ||.      :|||
 Worm   115 CNS------VAGV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9338NP_610071.1 TFP 23..125 CDD:480272 32/117 (27%)
C15H9.9NP_509029.1 TFP 18..117 CDD:480272 33/125 (26%)

Return to query results.
Submit another query.