powered by:
Protein Alignment CG9336 and CG31676
DIOPT Version :9
Sequence 1: | NP_610069.2 |
Gene: | CG9336 / 35355 |
FlyBaseID: | FBgn0032897 |
Length: | 148 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001286113.1 |
Gene: | CG31676 / 35351 |
FlyBaseID: | FBgn0051676 |
Length: | 159 |
Species: | Drosophila melanogaster |
Alignment Length: | 65 |
Identity: | 23/65 - (35%) |
Similarity: | 36/65 - (55%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 NATGCMKKTLESVAGHPQIVRSCYFGDINNIQAGCQSDPSMPFVKQLGCDVCTKDECNGSSSLAP 132
||....||.::.|.|...|.|||::.|:::....|.:|.:..::|.:.|..||.|.|||:|...|
Fly 73 NARPVCKKLVQEVYGKRVISRSCFYEDMDDSADKCANDQTSSYIKTVYCRTCTTDGCNGASGATP 137
Fly 133 132
Fly 138 137
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9336 | NP_610069.2 |
QVR |
24..125 |
CDD:407231 |
18/56 (32%) |
CG31676 | NP_001286113.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR33562 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.