DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9336 and CG31676

DIOPT Version :9

Sequence 1:NP_610069.2 Gene:CG9336 / 35355 FlyBaseID:FBgn0032897 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001286113.1 Gene:CG31676 / 35351 FlyBaseID:FBgn0051676 Length:159 Species:Drosophila melanogaster


Alignment Length:65 Identity:23/65 - (35%)
Similarity:36/65 - (55%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NATGCMKKTLESVAGHPQIVRSCYFGDINNIQAGCQSDPSMPFVKQLGCDVCTKDECNGSSSLAP 132
            ||....||.::.|.|...|.|||::.|:::....|.:|.:..::|.:.|..||.|.|||:|...|
  Fly    73 NARPVCKKLVQEVYGKRVISRSCFYEDMDDSADKCANDQTSSYIKTVYCRTCTTDGCNGASGATP 137

  Fly   133  132
              Fly   138  137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9336NP_610069.2 QVR 24..125 CDD:407231 18/56 (32%)
CG31676NP_001286113.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.