DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9336 and CG14275

DIOPT Version :9

Sequence 1:NP_610069.2 Gene:CG9336 / 35355 FlyBaseID:FBgn0032897 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_609211.1 Gene:CG14275 / 34144 FlyBaseID:FBgn0032022 Length:148 Species:Drosophila melanogaster


Alignment Length:138 Identity:35/138 - (25%)
Similarity:54/138 - (39%) Gaps:31/138 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVAVMISLAC--------SAYAIKCYQCESLTMPKCG------LKFEADETLLLDCSRIGPPRY 59
            :|:...:...|        :..||:|:||.|.....||      .:.:.|...|.||        
  Fly     1 MAITTYVYAMCLVLAANLLTVNAIRCHQCNSHDNEDCGGLVVNTPRAQRDNQYLTDC-------- 57

  Fly    60 LQNFFPLRNATGCMKKTLESVAGHPQ--IVRSCYFGDINNIQAGCQSDPSMPFVKQLGCDVCTKD 122
                .|........:||:.:...:.:  |.|||.|.. ..||..|.:..:..: ||:.| .|..:
  Fly    58 ----VPPSGEVAFCRKTVINFEQNDERRIERSCGFIP-EKIQNACFTADNEGY-KQIIC-TCPDE 115

  Fly   123 ECNGSSSL 130
            .|||:|||
  Fly   116 GCNGASSL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9336NP_610069.2 QVR 24..125 CDD:407231 26/108 (24%)
CG14275NP_609211.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.