DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bero and rtv

DIOPT Version :10

Sequence 1:NP_610069.2 Gene:bero / 35355 FlyBaseID:FBgn0032897 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_572693.1 Gene:rtv / 32056 FlyBaseID:FBgn0261277 Length:151 Species:Drosophila melanogaster


Alignment Length:165 Identity:39/165 - (23%)
Similarity:54/165 - (32%) Gaps:60/165 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVAVMISL-ACSAYAIKCYQCES---LTMPKCGLKFEADE------TLLLDCSRIGPPRYLQNF 63
            |||..:||| :......:||||.|   |...|....|.|.:      ...:.|            
  Fly     8 LAVIFLISLVSIDGLLRRCYQCRSRGELGSCKDPFTFNATDVEQEPGVAAIPC------------ 60

  Fly    64 FPLRNATGCMKKTLESVAGHP------QIVRSCYFGDINNIQAG-------CQSDPSMPFVKQLG 115
                 |:|...|.:|....:.      .|.|.|       :|.|       | :|....:.|...
  Fly    61 -----ASGWCGKVIEGGGTYAIDDYDLAIQRMC-------VQRGPDDNMDRC-ADTIYNYKKVYM 112

  Fly   116 CDVCTKDECNGSSS-----------LAPIAGAILL 139
            | .|..|.|||:.|           :.|:.|:.||
  Fly   113 C-FCQGDLCNGARSWSSAPQMILITMLPLLGSWLL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beroNP_610069.2 TFP 23..127 CDD:480272 27/125 (22%)
rtvNP_572693.1 TFP_LU_ECD_Rtv 23..123 CDD:467118 27/125 (22%)

Return to query results.
Submit another query.