DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bero and C15H9.9

DIOPT Version :10

Sequence 1:NP_610069.2 Gene:bero / 35355 FlyBaseID:FBgn0032897 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_509029.1 Gene:C15H9.9 / 180885 WormBaseID:WBGene00015803 Length:137 Species:Caenorhabditis elegans


Alignment Length:84 Identity:28/84 - (33%)
Similarity:39/84 - (46%) Gaps:7/84 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VMISLACSAYA-IKCYQCESLTMPKCGLKFEADETLLLDCSRIGPPRYLQNFFPLRNATGCMKKT 76
            ::.|||....| |.||||.|...|.|    :|::...|:..:.......:..|....|.||.|.|
 Worm     8 LLASLALGVSANISCYQCTSNENPTC----DANDDGALEAFKKTCTPLTEGTFKGNAAVGCRKIT 68

  Fly    77 LESVAGHPQIVRSC-YFGD 94
             :||.|...:||.| |.|:
 Worm    69 -QSVEGVLSVVRECAYSGE 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beroNP_610069.2 TFP 23..127 CDD:480272 25/74 (34%)
C15H9.9NP_509029.1 TFP 18..117 CDD:480272 25/74 (34%)

Return to query results.
Submit another query.