DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9336 and K11H12.7

DIOPT Version :9

Sequence 1:NP_610069.2 Gene:CG9336 / 35355 FlyBaseID:FBgn0032897 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_499966.1 Gene:K11H12.7 / 176893 WormBaseID:WBGene00019663 Length:127 Species:Caenorhabditis elegans


Alignment Length:140 Identity:36/140 - (25%)
Similarity:62/140 - (44%) Gaps:22/140 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VMISLACSAYAIKCYQCESLTMPKCGLKFEADETLLLDCSRIGPPRYLQNFFPLRNA--TGCMKK 75
            |..||...:.|:.||.|.||..|:|...:|       ..::|.|   :::|..:::.  .|| :.
 Worm     6 VFASLFAVSAALNCYICNSLNQPECVHNYE-------KFNKICP---VKSFGGMKSVKPLGC-RV 59

  Fly    76 TLESVAGHPQIVRSC-YFG-DINNIQAGCQSDPSMPFVKQLGCDVCTKDECNGSSSLAPIAGAIL 138
            :.:.|.....|||.| |.| ||..     :|:.....|.:: ...|:::.||.:.|......| .
 Worm    60 SRQYVKEETSIVRECAYTGEDIER-----KSNKGSLGVSRV-YSQCSENLCNSAESSTHFLTA-A 117

  Fly   139 LFFGVARLLA 148
            :|..:.:|.|
 Worm   118 VFIAIFKLFA 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9336NP_610069.2 QVR 24..125 CDD:407231 25/104 (24%)
K11H12.7NP_499966.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.