DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twit and crim

DIOPT Version :10

Sequence 1:NP_610067.1 Gene:twit / 35353 FlyBaseID:FBgn0032895 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_648500.1 Gene:crim / 39321 FlyBaseID:FBgn0036198 Length:158 Species:Drosophila melanogaster


Alignment Length:159 Identity:39/159 - (24%)
Similarity:54/159 - (33%) Gaps:54/159 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HQKHHLQCWHCSSDTIG-AEDFCDVTFQEDNIPTDLIKERNINLLRSCNGTINSDH---ERAVCR 89
            |:...:.|:.|:|.|.| ||.|               ..|.|..|        .:|   ...:|.
  Fly    18 HEGSAIWCYRCTSATPGCAEKF---------------NWRGIGFL--------GEHCPEPDDICV 59

  Fly    90 KTVEENNGKLITKRFCYYTNK------SDPVELC-------------NITSPEKNVRR------I 129
            |..|....:....|.|.....      :|..|.|             |.|..|.:|||      .
  Fly    60 KVTERRGARETITRDCLSALSFRKDIPADKYEGCRPAAHDEKLANYVNHTIKEHDVRRDYYTDTT 124

  Fly   130 FCEDCLTDRCNGA--LAGASILEMLLLLP 156
            ||...|..|||||  |..::::.:|.|:|
  Fly   125 FCFCFLDHRCNGASGLQTSAVIGLLTLIP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twitNP_610067.1 TFP_LU_ECD_Twit 33..142 CDD:467122 32/137 (23%)
crimNP_648500.1 TFP_LU_ECD_Crim 21..137 CDD:467120 32/138 (23%)

Return to query results.
Submit another query.